Recombinant Full Length Rat C-X-C Chemokine Receptor Type 3(Cxcr3) Protein, His-Tagged
Cat.No. : | RFL12193RF |
Product Overview : | Recombinant Full Length Rat C-X-C chemokine receptor type 3(Cxcr3) Protein (Q9JII9) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-367) |
Form : | Lyophilized powder |
AA Sequence : | MYLEVSERQVLDASDIAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPVLYS LLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAAQWVFGS GLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPWVRVALTCIVVWGLCVL FALPDFIFLSASHDQRLNATHCQYNFPQVGRTALRVLQLVAGFLMPLLVMAYCYAHILAV LLVSRGQRRFRAMRLVVVVVVAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKS VTSGMGYMHCCLNPLLYAFVGVKFKEQMWMLLMRLGRSDQRGPQRQPSSSRRESSWSETT EASYLGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cxcr3 |
Synonyms | Cxcr3; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; Interferon-inducible protein 10 receptor; IP-10 receptor; CD antigen CD183 |
UniProt ID | Q9JII9 |
◆ Recombinant Proteins | ||
CXCR3-1353R | Recombinant Rat CXCR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR3-2709H | Recombinant Human CXCR3 Full Length Transmembrane protein (1-368 aa), His-tagged | +Inquiry |
CXCR3-28064TH | Recombinant Human CXCR3, GST-tagged | +Inquiry |
CXCR3-279H | Recombinant Human CXCR3 Full Length Transmembrane protein (1-368 aa), His-tagged | +Inquiry |
CXCR3-16H | Recombinant Human CXCR3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR3-7162HCL | Recombinant Human CXCR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcr3 Products
Required fields are marked with *
My Review for All Cxcr3 Products
Required fields are marked with *