Recombinant Full Length Human DCAF7 Protein, GST-tagged
| Cat.No. : | DCAF7-3456HF |
| Product Overview : | Human HAN11 full-length ORF ( AAH01264, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 342 amino acids |
| Description : | This gene encodes a protein with multiple WD40 repeats which facilitate protein-protein interactions and thereby enable the assembly of multiprotein complexes. This protein has been shown to function as a scaffold protein for protein complexes involved in kinase signaling. This highly conserved gene is present in eukaryotic plants, fungi, and animals. The ortholog of this gene was first identified in plants as a key regulator of anthocyanin biosynthesis and flower pigmentation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014] |
| Molecular Mass : | 63.14 kDa |
| AA Sequence : | MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCAF7 DDB1 and CUL4 associated factor 7 [ Homo sapiens (human) ] |
| Official Symbol | DCAF7 |
| Synonyms | DCAF7; DDB1 and CUL4 associated factor 7; AN11; HAN11; WDR68; SWAN-1; DDB1- and CUL4-associated factor 7; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; human anthocyanin; seven-WD-repeat protein of the AN11 family-1 |
| Gene ID | 10238 |
| mRNA Refseq | NM_005828 |
| Protein Refseq | NP_005819 |
| MIM | 605973 |
| UniProt ID | P61962 |
| ◆ Recombinant Proteins | ||
| DCAF7-30698TH | Recombinant Human DCAF7, His-tagged | +Inquiry |
| DCAF7-4210H | Recombinant Human DCAF7 protein, His-tagged | +Inquiry |
| DCAF7-0583H | Recombinant Human DCAF7 Protein (S2-V342), His/Strep tagged | +Inquiry |
| DCAF7-4565H | Recombinant Human DCAF7 Protein, GST-tagged | +Inquiry |
| DCAF7-3761H | Recombinant Human DCAF7 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCAF7-7055HCL | Recombinant Human DCAF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCAF7 Products
Required fields are marked with *
My Review for All DCAF7 Products
Required fields are marked with *
