Recombinant Full Length Human DCAF7 Protein, GST-tagged

Cat.No. : DCAF7-3456HF
Product Overview : Human HAN11 full-length ORF ( AAH01264, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 342 amino acids
Description : This gene encodes a protein with multiple WD40 repeats which facilitate protein-protein interactions and thereby enable the assembly of multiprotein complexes. This protein has been shown to function as a scaffold protein for protein complexes involved in kinase signaling. This highly conserved gene is present in eukaryotic plants, fungi, and animals. The ortholog of this gene was first identified in plants as a key regulator of anthocyanin biosynthesis and flower pigmentation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
Molecular Mass : 63.14 kDa
AA Sequence : MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DCAF7 DDB1 and CUL4 associated factor 7 [ Homo sapiens (human) ]
Official Symbol DCAF7
Synonyms DCAF7; DDB1 and CUL4 associated factor 7; AN11; HAN11; WDR68; SWAN-1; DDB1- and CUL4-associated factor 7; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; human anthocyanin; seven-WD-repeat protein of the AN11 family-1
Gene ID 10238
mRNA Refseq NM_005828
Protein Refseq NP_005819
MIM 605973
UniProt ID P61962

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCAF7 Products

Required fields are marked with *

My Review for All DCAF7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon