Recombinant Full Length Human EFNA3 Protein, GST-tagged
Cat.No. : | EFNA3-4217HF |
Product Overview : | Human EFNA3 full-length ORF ( AAH17722, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 238 amino acids |
Description : | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 51.92 kDa |
AA Sequence : | MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EFNA3 ephrin-A3 [ Homo sapiens ] |
Official Symbol | EFNA3 |
Synonyms | EFNA3; ephrin-A3; EPLG3; Ehk1 L; LERK3; EFL-2; LERK-3; EHK1 ligand; ligand of eph-related kinase 3; eph-related receptor tyrosine kinase ligand 3; EFL2; Ehk1-L; |
Gene ID | 1944 |
mRNA Refseq | NM_004952 |
Protein Refseq | NP_004943 |
MIM | 601381 |
UniProt ID | P52797 |
◆ Recombinant Proteins | ||
EFNA3-177H | Active Recombinant Human EFNA3, Fc Chimera | +Inquiry |
EFNA3-155H | Active Recombinant Human EFNA3 protein, His-tagged | +Inquiry |
EFNA3-699H | Active Recombinant Human EFNA3 protein(Met 1-Ser 213) | +Inquiry |
EFNA3-196H | Active Recombinant Human EFNA3 protein, hFc-tagged | +Inquiry |
EFNA3-579H | Recombinant Human ephrin-A3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA3-2437HCL | Recombinant Human EFNA3 cell lysate | +Inquiry |
EFNA3-2160MCL | Recombinant Mouse EFNA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNA3 Products
Required fields are marked with *
My Review for All EFNA3 Products
Required fields are marked with *