Recombinant Human EREG
Cat.No. : | EREG-28692TH |
Product Overview : | Recombinant full length mature Human EREG with N terminal Methionine; 50aa, 6kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 49 amino acids |
Description : | Epiregulin is a member of the epidermal growth factor family. Epiregulin can function as a ligand of EGFR (epidermal growth factor receptor), as well as a ligand of most members of the ERBB (v-erb-b2 oncogene homolog) family of tyrosine-kinase receptors. |
Molecular Weight : | 6.000kDa |
Tissue specificity : | In normal adults, expressed predominantly in the placenta and peripheral blood leukocytes. High levels were detected in carcinomas of the bladder, lung, kidney and colon. |
Biological activity : | The ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is500,000 units/mg. |
Form : | Lyophilised:It is recommended to reconstitute in sterile Ultra pure water at not less than 100μg/ml, which can then be further diluted to other aqueous solutions. |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 7.40Constituents:PBS, 0.76% Sodium chloride |
Storage : | Please see Notes section |
Sequences of amino acids : | MVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL |
Sequence Similarities : | Contains 1 EGF-like domain. |
Gene Name | EREG epiregulin [ Homo sapiens ] |
Official Symbol | EREG |
Synonyms | EREG; epiregulin; proepiregulin; ER; |
Gene ID | 2069 |
mRNA Refseq | NM_001432 |
Protein Refseq | NP_001423 |
MIM | 602061 |
Uniprot ID | O14944 |
Chromosome Location | 4q21.21 |
Pathway | ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; ErbB4 signaling events, organism-specific biosystem; |
Function | epidermal growth factor receptor binding; epidermal growth factor receptor binding; growth factor activity; protein binding; |
◆ Recombinant Proteins | ||
EREG-235H | Recombinant Human EREG protein | +Inquiry |
EREG-1077C | Recombinant Chicken EREG | +Inquiry |
EREG-004H | Active Recombinant Human EREG Protein | +Inquiry |
EREG-28692TH | Recombinant Human EREG | +Inquiry |
EREG-001H | Recombinant Human EREG Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EREG-1868HCL | Recombinant Human EREG cell lysate | +Inquiry |
EREG-1871MCL | Recombinant Mouse EREG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EREG Products
Required fields are marked with *
My Review for All EREG Products
Required fields are marked with *