Recombinant Human EREG

Cat.No. : EREG-28692TH
Product Overview : Recombinant full length mature Human EREG with N terminal Methionine; 50aa, 6kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 49 amino acids
Description : Epiregulin is a member of the epidermal growth factor family. Epiregulin can function as a ligand of EGFR (epidermal growth factor receptor), as well as a ligand of most members of the ERBB (v-erb-b2 oncogene homolog) family of tyrosine-kinase receptors.
Molecular Weight : 6.000kDa
Tissue specificity : In normal adults, expressed predominantly in the placenta and peripheral blood leukocytes. High levels were detected in carcinomas of the bladder, lung, kidney and colon.
Biological activity : The ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is500,000 units/mg.
Form : Lyophilised:It is recommended to reconstitute in sterile Ultra pure water at not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Purity : by SDS-PAGE
Storage buffer : pH: 7.40Constituents:PBS, 0.76% Sodium chloride
Storage : Please see Notes section
Sequences of amino acids : MVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL
Sequence Similarities : Contains 1 EGF-like domain.
Gene Name EREG epiregulin [ Homo sapiens ]
Official Symbol EREG
Synonyms EREG; epiregulin; proepiregulin; ER;
Gene ID 2069
mRNA Refseq NM_001432
Protein Refseq NP_001423
MIM 602061
Uniprot ID O14944
Chromosome Location 4q21.21
Pathway ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; ErbB4 signaling events, organism-specific biosystem;
Function epidermal growth factor receptor binding; epidermal growth factor receptor binding; growth factor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EREG Products

Required fields are marked with *

My Review for All EREG Products

Required fields are marked with *

0
cart-icon