Recombinant Human EREG Protein, His-tagged

• Cat.No.: EREG-001H
• Product Overview: Recombinant Human EREG Protein, His-tagged,was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 63-108 aa
• Tag: C-His
• Molecular Mass: 6 kDa
• AA Sequence: VSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.5mg/ml by BCA
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol

Gene Information

• Gene Name: EREG epiregulin [ Homo sapiens (human) ]
• Official Symbol: EREG
• Synonyms: EREG; epiregulin; proepiregulin; ER
• Gene ID: 2069
• mRNA Refseq: NM_001432
• Protein Refseq: NP_001423
• MIM: 602061
• UniProt ID: O14944