Recombinant Human EREG protein
Cat.No. : | EREG-235H |
Product Overview : | Recombinant Human EREG protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 49 |
Description : | Epiregulin encoded by the EREG gene in humans, is a member of the EGF family of growth factors. This family also includes epidermal growth factor (EGF), transforming growth factor (TGF)-alpha, amphiregulin (ARG), HB (heparin-binding)-EGF, betacellulin, and the various heregulins. Epiregulin is expressed mainly in the placenta and peripheral blood leukocytes and in certain carcinomas of the bladder, lung, kidney and colon. It stimulates the proliferation of keratinocytes, hepatocytes, fibroblasts and vascular smooth muscle cells. Additionally, it inhibits the growth of several tumor-derived epithelial cell lines. Human Epiregulin is initially synthesized as a glycosylated 19.0 kDa transmembrane precursor protein, which is processed by proteolytic cleavage to produce a 6.0 kDa mature secreted sequence. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 5.6 kDa, a single non-glycosylated polypeptide chain containing 49 amino acids. |
AA Sequence : | VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL |
Endotoxin : | Less than 1 EU/μg of rHuEpiregulin as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | EREG |
Official Symbol | EREG |
Synonyms | EREG; epiregulin; proepiregulin; ER; |
Gene ID | 2069 |
mRNA Refseq | NM_001432 |
Protein Refseq | NP_001423 |
MIM | 602061 |
UniProt ID | O14944 |
◆ Recombinant Proteins | ||
EREG-235H | Recombinant Human EREG protein | +Inquiry |
EREG-4564HF | Recombinant Full Length Human EREG Protein, GST-tagged | +Inquiry |
EREG-28692TH | Recombinant Human EREG | +Inquiry |
EREG-004H | Active Recombinant Human EREG Protein | +Inquiry |
EREG-562H | Active Recombinant Human EREG protein(Val63-Leu108), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EREG-1868HCL | Recombinant Human EREG cell lysate | +Inquiry |
EREG-1871MCL | Recombinant Mouse EREG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EREG Products
Required fields are marked with *
My Review for All EREG Products
Required fields are marked with *
0
Inquiry Basket