Recombinant Human FCER1A Protein (26-205 aa), His-tagged
Cat.No. : | FCER1A-2099H |
Product Overview : | Recombinant Human FCER1A Protein (26-205 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 26-205 aa |
Description : | Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 23.0 kDa |
AA Sequence : | VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens ] |
Official Symbol | FCER1A |
Synonyms | FCER1A; alpha polypeptide; FCE1A; Fc-epsilon RI-alpha; FcERI; |
Gene ID | 2205 |
mRNA Refseq | NM_002001 |
Protein Refseq | NP_001992 |
MIM | 147140 |
UniProt ID | P12319 |
◆ Recombinant Proteins | ||
Fcer1a-1472M | Recombinant Mouse Fcer1a protein, His-tagged | +Inquiry |
Fcer1a-8688M | Recombinant Mouse Fcer1a protein(Met1-Gln204), hFc-tagged | +Inquiry |
FCER1A-311H | Recombinant Human Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide, His-tagged | +Inquiry |
FCER1A-2099H | Recombinant Human FCER1A Protein (26-205 aa), His-tagged | +Inquiry |
FCER1A-1458C | Active Recombinant Cynomolgus FCER1A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER1A Products
Required fields are marked with *
My Review for All FCER1A Products
Required fields are marked with *