Recombinant Human FCER1A Protein (26-205 aa), His-tagged

• Cat.No.: FCER1A-2099H
• Product Overview: Recombinant Human FCER1A Protein (26-205 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 26-205 aa
• Description: Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 23.0 kDa
• AA Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens ]
• Official Symbol: FCER1A
• Synonyms: FCER1A; alpha polypeptide; FCE1A; Fc-epsilon RI-alpha; FcERI
• Gene ID: 2205
• mRNA Refseq: NM_002001
• Protein Refseq: NP_001992
• MIM: 147140
• UniProt ID: P12319