Recombinant Mouse Fcer1a protein, His-SUMO-tagged
Cat.No. : | Fcer1a-2376M |
Product Overview : | Recombinant Mouse Fcer1a protein(P20489)(24-250aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-250aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.7 kDa |
AA Sequence : | ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fcer1a Fc receptor, IgE, high affinity I, alpha polypeptide [ Mus musculus ] |
Official Symbol | Fcer1a |
Synonyms | FCER1A; Fc receptor, IgE, high affinity I, alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; fc-epsilon RI-alpha; igE Fc receptor subunit alpha; FcERI; Fce1a; Fcr-5; fcepsilonri; |
Gene ID | 14125 |
mRNA Refseq | NM_010184 |
Protein Refseq | NP_034314 |
◆ Recombinant Proteins | ||
FCER1A-204H | Recombinant Human FCER1A, His-tagged | +Inquiry |
RFL29863MF | Recombinant Full Length Mouse High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha(Fcer1A) Protein, His-Tagged | +Inquiry |
FCER1A-2929H | Recombinant Human FCER1A Protein, His (Fc)-Avi-tagged | +Inquiry |
FCER1A-237H | Recombinant Human FCER1A | +Inquiry |
FCER1A-28166TH | Recombinant Human FCER1A, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fcer1a Products
Required fields are marked with *
My Review for All Fcer1a Products
Required fields are marked with *
0
Inquiry Basket