Recombinant Full Length Rat High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha(Fcer1A) Protein, His-Tagged
| Cat.No. : | RFL15030RF |
| Product Overview : | Recombinant Full Length Rat High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a) Protein (P12371) (24-245aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (24-245) |
| Form : | Lyophilized powder |
| AA Sequence : | ATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Fcer1a |
| Synonyms | Fcer1a; Fce1a; High affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; FcERI; IgE Fc receptor subunit alpha |
| UniProt ID | P12371 |
| ◆ Recombinant Proteins | ||
| FCER1A-25H | Active Recombinant Human FCER1A Protein (26-205aa), C-His tagged | +Inquiry |
| FCER1A-2099H | Recombinant Human FCER1A Protein (26-205 aa), His-tagged | +Inquiry |
| FCER1A-2304R | Recombinant Rat Fc epsilon receptor Ia Protein, His tagged | +Inquiry |
| FCER1A-1458C | Active Recombinant Cynomolgus FCER1A protein, His-tagged | +Inquiry |
| Fcer1a-8688M | Recombinant Mouse Fcer1a protein(Met1-Gln204), hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
| FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fcer1a Products
Required fields are marked with *
My Review for All Fcer1a Products
Required fields are marked with *
