Recombinant Full Length Rat High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha(Fcer1A) Protein, His-Tagged
Cat.No. : | RFL15030RF |
Product Overview : | Recombinant Full Length Rat High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a) Protein (P12371) (24-245aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-245) |
Form : | Lyophilized powder |
AA Sequence : | ATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fcer1a |
Synonyms | Fcer1a; Fce1a; High affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; FcERI; IgE Fc receptor subunit alpha |
UniProt ID | P12371 |
◆ Recombinant Proteins | ||
FCER1A-311H | Recombinant Human Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide, His-tagged | +Inquiry |
FCER1A-6928HF | Recombinant Full Length Human FCER1A Protein, GST-tagged | +Inquiry |
FCER1A-204H | Recombinant Human FCER1A, His-tagged | +Inquiry |
FCER1A-193H | Active Recombinant Human FCER1A, His-tagged, Biotinylated | +Inquiry |
Fcer1a-1472M | Recombinant Mouse Fcer1a protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fcer1a Products
Required fields are marked with *
My Review for All Fcer1a Products
Required fields are marked with *
0
Inquiry Basket