Recombinant Human FXN Protein, GST-tagged
Cat.No. : | FXN-4576H |
Product Overview : | Human FXN full-length ORF ( AAH48097.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq |
Molecular Mass : | 49.5 kDa |
AA Sequence : | MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FXN frataxin [ Homo sapiens ] |
Official Symbol | FXN |
Synonyms | FXN; frataxin; FRDA, Friedreich ataxia; frataxin, mitochondrial; CyaY; FA; FARR; X25; Friedreich ataxia protein; FRDA; MGC57199; |
Gene ID | 2395 |
mRNA Refseq | NM_000144 |
Protein Refseq | NP_000135 |
MIM | 606829 |
UniProt ID | Q16595 |
◆ Recombinant Proteins | ||
FXN-3162H | Recombinant Human FXN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FXN-530C | Recombinant Cynomolgus FXN Protein, His-tagged | +Inquiry |
FXN-6100M | Recombinant Mouse FXN Protein | +Inquiry |
Fxn-2934R | Recombinant Rat Fxn protein | +Inquiry |
FxN-4373H | Recombinant Human FxN protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXN Products
Required fields are marked with *
My Review for All FXN Products
Required fields are marked with *