Recombinant Human FXN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FXN-3162H |
Product Overview : | FXN MS Standard C13 and N15-labeled recombinant protein (NP_000135) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 23.1 kDa |
AA Sequence : | MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FXN frataxin [ Homo sapiens (human) ] |
Official Symbol | FXN |
Synonyms | FXN; frataxin; FRDA, Friedreich ataxia; frataxin, mitochondrial; CyaY; FA; FARR; X25; Friedreich ataxia protein; FRDA; MGC57199; |
Gene ID | 2395 |
mRNA Refseq | NM_000144 |
Protein Refseq | NP_000135 |
MIM | 606829 |
UniProt ID | Q16595 |
◆ Recombinant Proteins | ||
Fxn-7819M | Recombinant Mouse Fxn protein, His & T7-tagged | +Inquiry |
FXN-1823H | Recombinant Human FXN protein, His-tagged | +Inquiry |
FXN-4617C | Recombinant Cynomolgus monkey FXN protein, His-tagged | +Inquiry |
FXN-6100M | Recombinant Mouse FXN Protein | +Inquiry |
Fxn-1218R | Recombinant Rat Fxn Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXN Products
Required fields are marked with *
My Review for All FXN Products
Required fields are marked with *
0
Inquiry Basket