Recombinant Human FXN Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FXN-3162H |
| Product Overview : | FXN MS Standard C13 and N15-labeled recombinant protein (NP_000135) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 23.1 kDa |
| AA Sequence : | MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FXN frataxin [ Homo sapiens (human) ] |
| Official Symbol | FXN |
| Synonyms | FXN; frataxin; FRDA, Friedreich ataxia; frataxin, mitochondrial; CyaY; FA; FARR; X25; Friedreich ataxia protein; FRDA; MGC57199; |
| Gene ID | 2395 |
| mRNA Refseq | NM_000144 |
| Protein Refseq | NP_000135 |
| MIM | 606829 |
| UniProt ID | Q16595 |
| ◆ Recombinant Proteins | ||
| FXN-4576H | Recombinant Human FXN Protein, GST-tagged | +Inquiry |
| FXN-5271HF | Recombinant Full Length Human FXN Protein, GST-tagged | +Inquiry |
| FXN-1771R | Recombinant Rhesus monkey FXN Protein, His-tagged | +Inquiry |
| FXN-1060M | Recombinant Cynomolgus Monkey FXN Protein (81-210 aa), His-tagged | +Inquiry |
| FXN-1592R | Recombinant Rhesus Macaque FXN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXN Products
Required fields are marked with *
My Review for All FXN Products
Required fields are marked with *
