Recombinant Rat Fxn protein
| Cat.No. : | Fxn-2934R |
| Product Overview : | Recombinant Rat Fxn protein(D3ZYW7)(41-208aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 41-208aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.6 kDa |
| AA Sequence : | LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Fxn frataxin [ Rattus norvegicus ] |
| Official Symbol | Fxn |
| Synonyms | FXN; frataxin; frataxin, mitochondrial; RGD1565754; |
| Gene ID | 499335 |
| mRNA Refseq | NM_001191952 |
| Protein Refseq | NP_001178881 |
| ◆ Recombinant Proteins | ||
| FXN-530C | Recombinant Cynomolgus FXN Protein, His-tagged | +Inquiry |
| Fxn-2933M | Recombinant Mouse Fxn protein, His-tagged | +Inquiry |
| FXN-3398M | Recombinant Mouse FXN Protein, His (Fc)-Avi-tagged | +Inquiry |
| FXN-4372H | Recombinant Human FXN protein, His-SUMO & Myc-tagged | +Inquiry |
| FXN-1060M | Recombinant Cynomolgus Monkey FXN Protein (81-210 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fxn Products
Required fields are marked with *
My Review for All Fxn Products
Required fields are marked with *
