Recombinant Human FxN protein, His&Myc-tagged
| Cat.No. : | FxN-4373H |
| Product Overview : | Recombinant Human FxN protein(Q16595)(1-210aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-210aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.1 kDa |
| AA Sequence : | MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSG kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FXN frataxin [ Homo sapiens ] |
| Official Symbol | FxN |
| Synonyms | FXN; frataxin; FRDA, Friedreich ataxia; frataxin, mitochondrial; CyaY; FA; FARR; X25; Friedreich ataxia protein; FRDA; MGC57199; |
| Gene ID | 2395 |
| mRNA Refseq | NM_000144 |
| Protein Refseq | NP_000135 |
| MIM | 606829 |
| UniProt ID | Q16595 |
| ◆ Recombinant Proteins | ||
| Fxn-2932M | Recombinant Mouse Fxn protein, His-SUMO-tagged | +Inquiry |
| Fxn-1218R | Recombinant Rat Fxn Protein, His-tagged | +Inquiry |
| FXN-1060M | Recombinant Cynomolgus Monkey FXN Protein (81-210 aa), His-tagged | +Inquiry |
| FXN-5271HF | Recombinant Full Length Human FXN Protein, GST-tagged | +Inquiry |
| Fxn-3112M | Recombinant Mouse Fxn Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FxN Products
Required fields are marked with *
My Review for All FxN Products
Required fields are marked with *



