Recombinant Human HDAC1 protein, His-tagged
Cat.No. : | HDAC1-2507H |
Product Overview : | Recombinant Human HDAC1 protein(183-482 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 183-482 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HDAC1 histone deacetylase 1 [ Homo sapiens ] |
Official Symbol | HDAC1 |
Synonyms | HDAC1; histone deacetylase 1; RPD3L1; GON 10; HD1; reduced potassium dependency, yeast homolog-like 1; RPD3; GON-10; DKFZp686H12203; |
Gene ID | 3065 |
mRNA Refseq | NM_004964 |
Protein Refseq | NP_004955 |
MIM | 601241 |
UniProt ID | Q13547 |
◆ Recombinant Proteins | ||
HDAC1-20R | Recombinant Rat HDAC1 protein(Met1~Ala482), His-tagged | +Inquiry |
HDAC1-7526M | Recombinant Mouse HDAC1 Protein | +Inquiry |
HDAC1-8331H | Recombinant Human HDAC1, His tagged | +Inquiry |
HDAC1-392H | Active Recombinant Human Histone Deacetylase 1, His-tagged | +Inquiry |
HDAC1-527H | Recombinant Human HDAC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC1-5608HCL | Recombinant Human HDAC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC1 Products
Required fields are marked with *
My Review for All HDAC1 Products
Required fields are marked with *
0
Inquiry Basket