Recombinant Human IL12A Protein

Cat.No. : IL12A-75H
Product Overview : Recombinant Human Interleukin-12 is produced by our Mammalian expression system and the target gene encoding Arg23-Ser219&Ile23-Ser328 is expressed.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Protein Length : Arg23-Ser219&Ile23-Ser328
Description : IL-12 is involved in the differentiation of naive T cells into Th1 cells. It is known as a T cell-stimulating factor, which can stimulate the growth and function of T cells. It stimulates the production of interferon-gamma (IFN-γ) and tumor necrosis factor-alpha (TNF-α) from T cells and natural killer (NK) cells, and reduces IL-4 mediated suppression of IFN-γ. T cells that produce IL-12 have a coreceptor, CD30, which is associated with IL-12 activity.IL-12 plays an important role in the activities of natural killer cells and T lymphocytes. IL-12 mediates enhancement of the cytotoxic activity of NK cells and CD8+ cytotoxic T lymphocytes.
Form : Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
AA Sequence : RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTK NESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLA VIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS&IWELKKDVYVVEL DWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLL LHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGA ATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQ LKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRA QDRYYSSSWSEWASVPCS
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >95%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Quality Statement : Purity: Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name IL12A interleukin 12A [ Homo sapiens (human) ]
Official Symbol IL12A
Synonyms Interleukin-12 subunit alpha;IL-12A;Cytotoxic lymphocyte maturation factor 35 kDa subunit; IL-12 subunit p35;NK cell;IL12A; stimulatory factor chain 1; P35; CLMF; NFSK; NKSF1; IL-12A
Gene ID 3592
mRNA Refseq NM_000882.4
Protein Refseq NP_000873
MIM 161560
UniProt ID P29459

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL12A Products

Required fields are marked with *

My Review for All IL12A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon