Recombinant Human IL12A Protein
Cat.No. : | IL12A-75H |
Product Overview : | Recombinant Human Interleukin-12 is produced by our Mammalian expression system and the target gene encoding Arg23-Ser219&Ile23-Ser328 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Protein Length : | Arg23-Ser219&Ile23-Ser328 |
Description : | IL-12 is involved in the differentiation of naive T cells into Th1 cells. It is known as a T cell-stimulating factor, which can stimulate the growth and function of T cells. It stimulates the production of interferon-gamma (IFN-γ) and tumor necrosis factor-alpha (TNF-α) from T cells and natural killer (NK) cells, and reduces IL-4 mediated suppression of IFN-γ. T cells that produce IL-12 have a coreceptor, CD30, which is associated with IL-12 activity.IL-12 plays an important role in the activities of natural killer cells and T lymphocytes. IL-12 mediates enhancement of the cytotoxic activity of NK cells and CD8+ cytotoxic T lymphocytes. |
Form : | Lyophilized from a 0.2 um filtered solution of PBS, pH7.4. |
AA Sequence : | RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTK NESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLA VIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS&IWELKKDVYVVEL DWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLL LHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGA ATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQ LKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRA QDRYYSSSWSEWASVPCS |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | IL12A interleukin 12A [ Homo sapiens (human) ] |
Official Symbol | IL12A |
Synonyms | Interleukin-12 subunit alpha;IL-12A;Cytotoxic lymphocyte maturation factor 35 kDa subunit; IL-12 subunit p35;NK cell;IL12A; stimulatory factor chain 1; P35; CLMF; NFSK; NKSF1; IL-12A |
Gene ID | 3592 |
mRNA Refseq | NM_000882.4 |
Protein Refseq | NP_000873 |
MIM | 161560 |
UniProt ID | P29459 |
◆ Recombinant Proteins | ||
IL12A-113H | Active Recombinant Human IL12A | +Inquiry |
Il12a-209M | Recombinant Murine Interleukin 12a | +Inquiry |
IL12A-587H | Recombinant Human IL12A protein, His-tagged | +Inquiry |
IL12A-9483R | Recombinant Rhesus IL12A protein, hFc-tagged | +Inquiry |
IL12A-75H | Recombinant Human IL12A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12A-2435HCL | Recombinant Human IL12A cell lysate | +Inquiry |
IL12A-001CCL | Recombinant Cynomolgus IL12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12A Products
Required fields are marked with *
My Review for All IL12A Products
Required fields are marked with *