Recombinant Human IL28RA Protein, GST-tagged
Cat.No. : | IL28RA-5201H |
Product Overview : | Human IL28RA partial ORF ( NP_734464, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IL28RA interleukin 28 receptor, alpha (interferon, lambda receptor) [ Homo sapiens ] |
Official Symbol | IL28RA |
Synonyms | IL28RA; interleukin 28 receptor, alpha (interferon, lambda receptor); interleukin 28 receptor, alpha; interleukin-28 receptor subunit alpha; CRF2/12; IFNLR; IL 28R1; interferon lambda receptor 1; CRF2-12; IL-28RA; IL-28R-alpha; IFN-lambda-R1; IFN-lambda receptor 1; interleukin 28 receptor A; IL-28 receptor subunit alpha; interferon lambda, receptor 1; interleukin 28 alpha receptor; class II cytokine receptor CRF2/12; interleukin or cytokine receptor 2; cytokine receptor class-II member 12; cytokine receptor family 2 member 12; likely interleukin or cytokine receptor 2; LICR2; IFNLR1; IL-28R1; |
Gene ID | 163702 |
mRNA Refseq | NM_170743 |
Protein Refseq | NP_734464 |
MIM | 607404 |
UniProt ID | Q8IU57 |
◆ Recombinant Proteins | ||
Il28ra-5658M | Active Recombinant Mouse Interleukin 28 Receptor Alpha, Fc-tagged | +Inquiry |
Il28ra-74M | Recombinant Mouse Il28ra Protein, His (Fc)-Avi-tagged | +Inquiry |
IL28RA-49H | Recombinant Human IL28RA protein, GST-tagged | +Inquiry |
IL28RA-841H | Recombinant Human IL28RA | +Inquiry |
IL28RA-5201H | Recombinant Human IL28RA Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL28RA Products
Required fields are marked with *
My Review for All IL28RA Products
Required fields are marked with *
0
Inquiry Basket