Recombinant Human IL28RA protein, GST-tagged

Cat.No. : IL28RA-49H
Product Overview : Recombinant Human IL28RA(28-222aa) fused with GST tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 28-222 a.a.
Description : The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
Form : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.
AA Sequence : QNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEV
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name IL28RA interleukin 28 receptor, alpha (interferon, lambda receptor) [ Homo sapiens ]
Official Symbol IL28RA
Synonyms IL28RA; interleukin 28 receptor, alpha (interferon, lambda receptor); interleukin 28 receptor, alpha; interleukin-28 receptor subunit alpha; CRF2/12; IFNLR; IL 28R1; interferon lambda receptor 1; CRF2-12; IL-28RA; IL-28R-alpha; IFN-lambda-R1; IFN-lambda receptor 1; interleukin 28 receptor A; IL-28 receptor subunit alpha; interferon lambda, receptor 1; interleukin 28 alpha receptor; class II cytokine receptor CRF2/12; interleukin or cytokine receptor 2; cytokine receptor class-II member 12; cytokine receptor family 2 member 12; likely interleukin or cytokine receptor 2; LICR2; IFNLR1; IL-28R1;
Gene ID 163702
mRNA Refseq NM_170743
Protein Refseq NP_734464
MIM 607404
UniProt ID Q8IU57
Chromosome Location 1p36.11
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function contributes_to cytokine receptor activity; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL28RA Products

Required fields are marked with *

My Review for All IL28RA Products

Required fields are marked with *

0
cart-icon