Recombinant Human IL2RG Protein, Fc-tagged
Cat.No. : | IL2RG-323H |
Product Overview : | Recombinant human IL2RG protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 369 |
Description : | The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder. |
Form : | Lyophilized |
Molecular Mass : | 53.5 kDa |
AA Sequence : | MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL2RG interleukin 2 receptor, gamma [ Homo sapiens (human) ] |
Official Symbol | IL2RG |
Synonyms | IL2RG; interleukin 2 receptor, gamma; CIDX, combined immunodeficiency, X linked , IMD4, SCIDX1, severe combined immunodeficiency; cytokine receptor common subunit gamma; CD132; gammaC; gamma(c); CD132 antigen; common gamma-chain; IL-2R subunit gamma; IL-2 receptor subunit gamma; severe combined immunodeficiency; combined immunodeficiency, X-linked; common cytokine receptor gamma chain; interleukin-2 receptor subunit gamma; P64; CIDX; IMD4; SCIDX; IL-2RG; SCIDX1; |
Gene ID | 3561 |
mRNA Refseq | NM_000206 |
Protein Refseq | NP_000197 |
MIM | 308380 |
UniProt ID | P31785 |
◆ Recombinant Proteins | ||
IL2RG-949H | Recombinant Human IL2RG Protein, GST-His-tagged | +Inquiry |
Il2rg-7456R | Recombinant Rat Il2rg protein, hFc-tagged | +Inquiry |
IL2RG-785H | Recombinant Human IL2RG protein, His-Avi-tagged | +Inquiry |
IL2RG-038H | Recombinant Human interleukin 2 receptor, gamma Protein, His tagged | +Inquiry |
IL2RG-119H | Recombinant Human IL2RG, Gamma, Fc Chimera | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RG-2908MCL | Recombinant Mouse IL2RG cell lysate | +Inquiry |
IL2RG-1481HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
IL2RG-1476RCL | Recombinant Rat IL2RG cell lysate | +Inquiry |
IL2RG-502HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL2RG Products
Required fields are marked with *
My Review for All IL2RG Products
Required fields are marked with *
0
Inquiry Basket