Active Recombinant Human IL3 Protein
Cat.No. : | IL3-168H |
Product Overview : | Recombinant Human IL3 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin 3 (IL-3) is a cytokine that is produced by activated T cells and mast cells. IL-3 induces the differentiation of hematopoietic stem cells into myeloid precursor cells, such as erythrocyte, megakaryocyte, granulocyte, monocyte, and dendritic cells. IL-3 also functions in the nervous system and is important during the B-1 cell regulation of chronic inflammatory diseases. |
Bio-activity : | TF-1 cell proliferation, ≤2 ng/mL |
Molecular Mass : | Monomer, 15.2 kDa (134 aa) |
AA Sequence : | MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.5. |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IL3 interleukin 3 (colony-stimulating factor, multiple) [ Homo sapiens (human) ] |
Official Symbol | IL3 |
Synonyms | IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF; |
Gene ID | 3562 |
mRNA Refseq | NM_000588 |
Protein Refseq | NP_000579 |
MIM | 147740 |
UniProt ID | P08700 |
◆ Recombinant Proteins | ||
IL3-88H | Recombinant Human GMCSF/IL-3 Fusion Protein | +Inquiry |
Il3-7242M | Active Recombinant Mouse Il3 Protein, His-tagged | +Inquiry |
IL3-1036H | Recombinant Human IL3 Protein, His-tagged | +Inquiry |
Il3-357I | Active Recombinant Mouse Il3 Protein (135 aa) | +Inquiry |
IL3-378H | Recombinant Human IL3, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL3 Products
Required fields are marked with *
My Review for All IL3 Products
Required fields are marked with *
0
Inquiry Basket