Active Recombinant Mouse Il3 Protein, His-tagged
Cat.No. : | Il3-7242M |
Product Overview : | Recombinant mouse IL3, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 27-166 |
Description : | This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. |
Form : | Liquid |
Bio-activity : | Measured in a cell proliferation assay using TF-1 human erythroleukemic cell. The ED50 for this effects is less or equal to 0.1 ng/mL. |
Molecular Mass : | 16.7 kDa |
AA Sequence : | ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVECLEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Il3 interleukin 3 [ Mus musculus (house mouse) ] |
Official Symbol | Il3 |
Synonyms | Il3; interleukin 3; B; P; Il; BPA; PSF; Csfm; HCGF; Il-3; MCGF; Csfmu; interleukin-3; P-cell-stimulating factor; hematopoietic growth factor; mast cell growth factor; multipotential colony-stimulating factor |
Gene ID | 16187 |
mRNA Refseq | NM_010556 |
Protein Refseq | NP_034686 |
UniProt ID | P01586 |
◆ Recombinant Proteins | ||
IL3-5760HF | Recombinant Full Length Human IL3 Protein, GST-tagged | +Inquiry |
Il3-357I | Active Recombinant Mouse Il3 Protein (135 aa) | +Inquiry |
IL3-08H | Recombinant Human IL3 protein | +Inquiry |
IL3-2250R | Recombinant Rhesus monkey IL3 Protein, His-tagged | +Inquiry |
IL3-1093R | Active Recombinant Rat IL3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il3 Products
Required fields are marked with *
My Review for All Il3 Products
Required fields are marked with *