Active Recombinant Mouse Il3 Protein, His-tagged

Cat.No. : Il3-7242M
Product Overview : Recombinant mouse IL3, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 27-166
Description : This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using TF-1 human erythroleukemic cell. The ED50 for this effects is less or equal to 0.1 ng/mL.
Molecular Mass : 16.7 kDa
AA Sequence : ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVECLEHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Il3 interleukin 3 [ Mus musculus (house mouse) ]
Official Symbol Il3
Synonyms Il3; interleukin 3; B; P; Il; BPA; PSF; Csfm; HCGF; Il-3; MCGF; Csfmu; interleukin-3; P-cell-stimulating factor; hematopoietic growth factor; mast cell growth factor; multipotential colony-stimulating factor
Gene ID 16187
mRNA Refseq NM_010556
Protein Refseq NP_034686
UniProt ID P01586

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il3 Products

Required fields are marked with *

My Review for All Il3 Products

Required fields are marked with *

0
cart-icon