Recombinant Human IL5RA, Fc-tagged
Cat.No. : | IL5RA-28136TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-327 of Human IL5RA fused to the Fc region of Human IgG1 (aa 93-330 expressed in modified Human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Protein Length : | 1-327 a.a. |
Description : | The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Several alternatively spliced transcript variants encoding four distinct isoforms have been reported. |
Conjugation : | Fc |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:DLLPDEKISLLPPVNFTIKVTGLAQVLLQ WKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGT SIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPE DTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILS KGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPL NVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGY LQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGL WSEWSQRIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK |
Gene Name | IL5RA interleukin 5 receptor, alpha [ Homo sapiens ] |
Official Symbol | IL5RA |
Synonyms | IL5RA; interleukin 5 receptor, alpha; IL5R; interleukin-5 receptor subunit alpha; CD125; CDw125; |
Gene ID | 3568 |
mRNA Refseq | NM_000564 |
Protein Refseq | NP_000555 |
MIM | 147851 |
Uniprot ID | Q01344 |
Chromosome Location | 3p26-p24 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
Function | interleukin-5 receptor activity; protein binding; receptor activity; |
◆ Recombinant Proteins | ||
IL5RA-241I | Active Recombinant Human IL5RA Protein | +Inquiry |
IL5RA-5687HF | Recombinant Full Length Human IL5RA Protein | +Inquiry |
IL5RA-069H | Recombinant Human IL5RA Protein, C-His-tagged | +Inquiry |
Il5ra-64M | Recombinant Mouse Il5ra Protein, His-tagged | +Inquiry |
RFL23168MF | Recombinant Full Length Mouse Interleukin-5 Receptor Subunit Alpha(Il5Ra) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IL5RA-620C | Recombinant Cynomolgus IL5RA Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5RA-001MCL | Recombinant Mouse IL5RA cell lysate | +Inquiry |
IL5RA-2060HCL | Recombinant Human IL5RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL5RA Products
Required fields are marked with *
My Review for All IL5RA Products
Required fields are marked with *
0
Inquiry Basket