Recombinant Cynomolgus IL5RA Protein, His tagged

Cat.No. : IL5RA-620C
Product Overview : Recombinant Cynomolgus IL5RA Protein with His tag was expressed in HEK293T.
Availability November 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : His
Protein Length : 21-340 aa
Description : The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Several alternatively spliced transcript variants encoding four distinct isoforms have been reported.
Molecular Mass : 38 kDa
AA Sequence : DLLPDDKISLLPPVNFTIKVTGLAQVLLRWEPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQKDHSLLASSWASAELHAPPGSPGTSVVNLTCTTNTTADNYSYLRPYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDSMGRNIACWFPRTFIHSRGRDWLAVLVNGSSKHSAIKPFDQLFALHAIDQINPPLNVTAEIKGTRLSIQWEKPVSAFPIHCFDYEVKIHNARNGYLQIEKMMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGKDEHKPLRHHHHHHHHHH
Endotoxin : <1 EU/μg by LAL
Purity : > 80% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.25 mg/mL by BCA
Gene Name IL5RA interleukin 5 receptor subunit alpha [ Homo sapiens (human) ]
Official Symbol IL5RA
Synonyms IL5RA; interleukin 5 receptor subunit alpha; IL5R; CD125; CDw125; HSIL5R3; interleukin-5 receptor subunit alpha; CD125 antigen; IL-5 receptor subunit alpha; IL-5R subunit alpha; interleukin 5 receptor type 3; interleukin 5 receptor, alpha; interleukin-5 receptor alpha chain
Gene ID 3568
mRNA Refseq NM_000564
Protein Refseq NP_000555
MIM 147851
UniProt ID Q01344

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL5RA Products

Required fields are marked with *

My Review for All IL5RA Products

Required fields are marked with *

0
cart-icon
0
compare icon