Recombinant Full Length Mouse Interleukin-5 Receptor Subunit Alpha(Il5Ra) Protein, His-Tagged
Cat.No. : | RFL23168MF |
Product Overview : | Recombinant Full Length Mouse Interleukin-5 receptor subunit alpha(Il5ra) Protein (P21183) (18-415aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (18-415) |
Form : | Lyophilized powder |
AA Sequence : | DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHLIVLPTAACFVLLIFSLICRVCHLWTRLFPPVPAPKSNIKDLPVVTEYEKPSNETKIEVVHCVEEVGFEVMGNSTF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Il5ra |
Synonyms | Il5ra; Il5r; Interleukin-5 receptor subunit alpha; IL-5 receptor subunit alpha; IL-5R subunit alpha; IL-5R-alpha; IL-5RA; CD antigen CD125 |
UniProt ID | P21183 |
◆ Recombinant Proteins | ||
IL5Ra-431M | Recombinant Mouse IL5Ra protein, His-tagged | +Inquiry |
Il5ra-64M | Recombinant Mouse Il5ra Protein, His-tagged | +Inquiry |
IL5RA-6744H | Recombinant Human IL5RA protein, hFc-tagged | +Inquiry |
Il5ra-7064M | Recombinant Mouse Il5ra protein, His & T7-tagged | +Inquiry |
IL5RA-4581C | Recombinant Chicken IL5RA | +Inquiry |
◆ Native Proteins | ||
IL5RA-620C | Recombinant Cynomolgus IL5RA Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5RA-001MCL | Recombinant Mouse IL5RA cell lysate | +Inquiry |
IL5RA-2060HCL | Recombinant Human IL5RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il5ra Products
Required fields are marked with *
My Review for All Il5ra Products
Required fields are marked with *
0
Inquiry Basket