Recombinant Human MPZ
Cat.No. : | MPZ-29152TH |
Product Overview : | Recombinant full length Human Myelin Protein Zero protein with an N terminal proprietary tag; predicted mwt: 54.12 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 258 amino acids |
Description : | This gene encodes a major structural protein of peripheral myelin. Mutations in this gene result in the autosomal dominant form of Charcot-Marie-Tooth disease type 1 and other polyneuropathies. |
Molecular Weight : | 54.120kDa inclusive of tags |
Tissue specificity : | Found only in peripheral nervous system Schwann cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAI VVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQP EGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDG SIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKV PTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAAL QRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTK AVSEKKAKGLGESRKDKK |
Sequence Similarities : | Belongs to the myelin P0 protein family.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name | MPZ myelin protein zero [ Homo sapiens ] |
Official Symbol | MPZ |
Synonyms | MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB; |
Gene ID | 4359 |
mRNA Refseq | NM_000530 |
Protein Refseq | NP_000521 |
MIM | 159440 |
Uniprot ID | P25189 |
Chromosome Location | 1q22 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
Function | structural molecule activity; |
◆ Recombinant Proteins | ||
MPZ-5524H | Recombinant Human MPZ Protein, GST-tagged | +Inquiry |
MPZ-29152TH | Recombinant Human MPZ | +Inquiry |
MPZ-1461H | Recombinant Human MPZ Protein (30-156 aa), His-tagged | +Inquiry |
RFL15417HF | Recombinant Full Length Heterodontus Francisci Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
RFL34972GF | Recombinant Full Length Chicken Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPZ Products
Required fields are marked with *
My Review for All MPZ Products
Required fields are marked with *
0
Inquiry Basket