Recombinant Full Length Human MPZ Protein
Cat.No. : | MPZ-314HF |
Product Overview : | Recombinant full length Human Myelin Protein Zero protein with an N terminal proprietary tag; predicted mwt: 54.12 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 258 amino acids |
Description : | This gene encodes a major structural protein of peripheral myelin. Mutations in this gene result in the autosomal dominant form of Charcot-Marie-Tooth disease type 1 and other polyneuropathies. |
Form : | Liquid |
Molecular Mass : | 54.120kDa inclusive of tags |
AA Sequence : | MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAI VVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQP EGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDG SIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKV PTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAAL QRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTK AVSEKKAKGLGESRKDKK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MPZ myelin protein zero [ Homo sapiens ] |
Official Symbol | MPZ |
Synonyms | MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB |
Gene ID | 4359 |
mRNA Refseq | NM_000530 |
Protein Refseq | NP_000521 |
MIM | 159440 |
UniProt ID | P25189 |
◆ Recombinant Proteins | ||
MPZ-4599H | Recombinant Human MPZ Protein (Ile30-Arg153), C-His tagged | +Inquiry |
MPZ-9712Z | Recombinant Zebrafish MPZ | +Inquiry |
MPZ-1218H | Recombinant Human MPZ Protein (30-156 aa), GST-tagged | +Inquiry |
RFL22345XF | Recombinant Full Length Xenopus Tropicalis Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
MPZ-6337HF | Recombinant Full Length Human MPZ Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPZ Products
Required fields are marked with *
My Review for All MPZ Products
Required fields are marked with *