Recombinant Full Length Human MPZ Protein
| Cat.No. : | MPZ-314HF |
| Product Overview : | Recombinant full length Human Myelin Protein Zero protein with an N terminal proprietary tag; predicted mwt: 54.12 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 258 amino acids |
| Description : | This gene encodes a major structural protein of peripheral myelin. Mutations in this gene result in the autosomal dominant form of Charcot-Marie-Tooth disease type 1 and other polyneuropathies. |
| Form : | Liquid |
| Molecular Mass : | 54.120kDa inclusive of tags |
| AA Sequence : | MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAI VVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQP EGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDG SIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKV PTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAAL QRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTK AVSEKKAKGLGESRKDKK |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | MPZ myelin protein zero [ Homo sapiens ] |
| Official Symbol | MPZ |
| Synonyms | MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB |
| Gene ID | 4359 |
| mRNA Refseq | NM_000530 |
| Protein Refseq | NP_000521 |
| MIM | 159440 |
| UniProt ID | P25189 |
| ◆ Recombinant Proteins | ||
| RFL22345XF | Recombinant Full Length Xenopus Tropicalis Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
| RFL29226MF | Recombinant Full Length Mouse Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
| MPZ-8493H | Recombinant Human MPZ protein, His-tagged | +Inquiry |
| RFL13370RF | Recombinant Full Length Rat Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
| MPZ-3744R | Recombinant Rat MPZ Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPZ Products
Required fields are marked with *
My Review for All MPZ Products
Required fields are marked with *
