Recombinant Full Length Human MPZ Protein
Cat.No. : | MPZ-314HF |
Product Overview : | Recombinant full length Human Myelin Protein Zero protein with an N terminal proprietary tag; predicted mwt: 54.12 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a major structural protein of peripheral myelin. Mutations in this gene result in the autosomal dominant form of Charcot-Marie-Tooth disease type 1 and other polyneuropathies. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 54.120kDa inclusive of tags |
Protein Length : | 258 amino acids |
AA Sequence : | MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAI VVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQP EGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDG SIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKV PTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAAL QRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTK AVSEKKAKGLGESRKDKK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | MPZ myelin protein zero [ Homo sapiens ] |
Official Symbol : | MPZ |
Synonyms : | MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB |
Gene ID : | 4359 |
mRNA Refseq : | NM_000530 |
Protein Refseq : | NP_000521 |
MIM : | 159440 |
UniProt ID : | P25189 |
Products Types
◆ Recombinant Protein | ||
Mpz-4131M | Recombinant Mouse Mpz Protein, Myc/DDK-tagged | +Inquiry |
Mpz-1791R | Recombinant Rat Mpz Protein, His&GST-tagged | +Inquiry |
MPZ-1461H | Recombinant Human MPZ Protein (30-156 aa), His-tagged | +Inquiry |
MPZ-1218H | Recombinant Human MPZ Protein (30-156 aa), GST-tagged | +Inquiry |
MPZ-5524H | Recombinant Human MPZ Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket