Recombinant Human NF1, GST-tagged
Cat.No. : | NF1-335H |
Product Overview : | Recombinant Human NF1(2719 a.a. - 2818 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene product appears to function as a negative regulator of the ras signal transduction pathway. Mutations in this gene have been linked to neurofibromatosis type 1, juvenile myelomonocytic leukemia and Watson syndrome. The mRNA for this gene is subject to RNA editing (CGA>UGA->Arg1306Term) resulting in premature translation termination. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTR HGSASQVQKQRSAGSFKRNSIKKIV |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NF1 neurofibromin 1 [ Homo sapiens (human) ] |
Official Symbol | NF1 |
Synonyms | NF1; WSS; NFNS; VRNF; neurofibromin 1; neurofibromin; neurofibromatosis-related protein NF-1 |
Gene ID | 4763 |
mRNA Refseq | NM_000267 |
Protein Refseq | NP_000258 |
MIM | 613113 |
UniProt ID | P21359 |
Chromosome Location | 17q11.2 |
Pathway | ATF-2 transcription factor network; FOXA2 and FOXA3 transcription factor networks; Integrated Breast Cancer Pathway |
Function | Ras GTPase activator activity; phosphatidylcholine binding; phosphatidylethanolamine binding |
◆ Recombinant Proteins | ||
NF1-3967R | Recombinant Rat NF1 Protein | +Inquiry |
NF1-32H | Active Recombinant Human NF1 Protein (1197-1528), N-His tagged | +Inquiry |
NF1-643C | Recombinant Chicken NF1 protein, His&Myc-tagged | +Inquiry |
NF1-3625R | Recombinant Rat NF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NF1-2983H | Recombinant Human NF1 protein(1566-1837aa), His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NF1 Products
Required fields are marked with *
My Review for All NF1 Products
Required fields are marked with *
0
Inquiry Basket