Recombinant Human NF1 Protein, His-tagged
| Cat.No. : | NF1-334H |
| Product Overview : | Recombinant Human NF1 protein with His tag was expressed in E.coli. |
| Availability | August 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene product appears to function as a negative regulator of the ras signal transduction pathway. Mutations in this gene have been linked to neurofibromatosis type 1, juvenile myelomonocytic leukemia and Watson syndrome. The mRNA for this gene is subject to RNA editing (CGA>UGA->Arg1306Term) resulting in premature translation termination. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. |
| Molecular Mass : | ~40.2 kDa, reducing conditions |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIVITSSDWQHVSFEVDPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPPQLRSVCHCLYQVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSKILQSIANHVLFTKEEHMRPFNDFVKSNFDAARRFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLAYLGPPEH |
| Purity : | >90%, by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.16 mg/mL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in 50 mM Tris-HCl, pH 7.5, 200 mM NaCl. |
| Publications : |
An essential role for Argonaute 2 in EGFR-KRAS signaling in pancreatic cancer development (2020)
|
| Gene Name | NF1 neurofibromin 1 [ Homo sapiens (human) ] |
| Official Symbol | NF1 |
| Synonyms | NF1; neurofibromin 1; WSS; NFNS; VRNF; neurofibromin; neurofibromatosis 1; neurofibromatosis-related protein NF-1; truncated neurofibromin 1 |
| Gene ID | 4763 |
| mRNA Refseq | NM_000267 |
| Protein Refseq | NP_000258 |
| MIM | 613113 |
| UniProt ID | P21359 |
| ◆ Recombinant Proteins | ||
| NF1-3625R | Recombinant Rat NF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NF1-643C | Recombinant Chicken NF1 protein, His&Myc-tagged | +Inquiry |
| NF1-2983H | Recombinant Human NF1 protein(1566-1837aa), His&Myc-tagged | +Inquiry |
| NF1-01HFL | Recombinant Full Length Human NF1 Protein, His&Strep-tagged | +Inquiry |
| NF1-334H | Recombinant Human NF1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NF1 Products
Required fields are marked with *
My Review for All NF1 Products
Required fields are marked with *
