Recombinant Full Length Human MGMT Protein, His tagged
| Cat.No. : | MGMT-121H |
| Product Overview : | Recombinant Full Length Human MGMT Protein (1-207 aa) with His tag was expressed in E. coli. |
| Availability | November 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Citation
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-207 aa |
| Description : | Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma. |
| Molecular Mass : | 23 kDa |
| AASequence : | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRNHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 0.5 mg/mL |
| Publications : |
Fluorogenic Real-Time Reporters of DNA Repair by MGMT, a Clinical Predictor of Antitumor Drug Response (2016)
Activatable Probes for Anti-Cancer Therapy (2019)
|
| Gene Name | MGMT O-6-methylguanine-DNA methyltransferase [ Homo sapiens (human) ] |
| Official Symbol | MGMT |
| Synonyms | MGMT; O-6-methylguanine-DNA methyltransferase; methylated-DNA--protein-cysteine methyltransferase; methylguanine-DNA methyltransferase; O-6-methylguanine-DNA-alkyltransferase; O6-methylguanine-DNA methyltransferase; 6-O-methylguanine-DNA methyltransferase; |
| Gene ID | 4255 |
| mRNA Refseq | NM_002412 |
| Protein Refseq | NP_002403 |
| MIM | 156569 |
| UniProt ID | P16455 |
| ◆ Recombinant Proteins | ||
| MGMT-3674R | Recombinant Rat MGMT Protein | +Inquiry |
| Mgmt-2125R | Recombinant Rat Mgmt protein, His & GST-tagged | +Inquiry |
| MGMT-075H | Recombinant Human MGMT Protein, His-tagged | +Inquiry |
| MGMT-3330R | Recombinant Rat MGMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| MGMT-2764R | Recombinant Rhesus monkey MGMT Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MGMT-1109HCL | Recombinant Human MGMT cell lysate | +Inquiry |
Fluorogenic Real-Time Reporters of DNA Repair by MGMT, a Clinical Predictor of Antitumor Drug Response
Journal: PLoS ONE PubMed ID: 27035132 Data: 2016/4/1
Authors: Andrew A. Beharry, Zachary D. Nagel, Robert W Sobol
Article Snippet:Purified recombinant human MGMT (His-tagged, expressed in E . Coli ) was purchased from Creative BioMart.. All assays were carried out at 37°C in 70 mM HEPES buffer (pH 7.8) containing 5 mM EDTA, 1 mM dithiothreitol and 50 μg/ml BSA.All assays were carried out at 37°C in 70 mM HEPES buffer (pH 7.8) containing 5 mM EDTA, 1 mM dithiothreitol and 50 μg/ml BSA.

Fluorescence spectra showing the overall fold-changes in intensity observed when comparing fluorescence measured before (dashed line) and after (solid line) addition

Incubation
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGMT Products
Required fields are marked with *
My Review for All MGMT Products
Required fields are marked with *
