Recombinant Full Length Human MGMT Protein, C-Flag-tagged
Cat.No. : | MGMT-1344HFL |
Product Overview : | Recombinant Full Length Human MGMT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | MLGQPAPLERFASRRPQVLAVRTVCDLVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTS AADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFG EVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP GLGGSSGLAGAWLKGAGATSGSPPAGRNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | MGMT O-6-methylguanine-DNA methyltransferase [ Homo sapiens (human) ] |
Official Symbol | MGMT |
Synonyms | methylguanine-DNA methyltransferase; O-6-methylguanine-DNA methyltransferase; O6-methylguanine-DNA methyltransferase; OTTHUMP00000020741 |
Gene ID | 4255 |
mRNA Refseq | NM_002412.5 |
Protein Refseq | NP_002403.3 |
MIM | 156569 |
UniProt ID | P16455 |
◆ Recombinant Proteins | ||
MGMT-6958H | Recombinant Human MGMT, His-tagged | +Inquiry |
MGMT-28449TH | Recombinant Human MGMT protein, His-tagged | +Inquiry |
MGMT-075H | Recombinant Human MGMT Protein, His-tagged | +Inquiry |
MGMT-814H | Recombinant Human O-6-methylguanine-DNA Methyltransferase, T7-tagged | +Inquiry |
MGMT-2585R | Recombinant Rhesus Macaque MGMT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGMT-1109HCL | Recombinant Human MGMT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGMT Products
Required fields are marked with *
My Review for All MGMT Products
Required fields are marked with *
0
Inquiry Basket