Recombinant Human PAX7
Cat.No. : | PAX7-29057TH |
Product Overview : | Recombinant fragment of Human PAX7 with N terminal proprietary tag, 38.21kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 111 amino acids |
Description : | This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 38.210kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT GYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCL FMESYKVVSGWGMSISQMEKLKSSQMEQFT |
Sequence Similarities : | Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.Contains 1 paired domain. |
Gene Name | PAX7 paired box 7 [ Homo sapiens ] |
Official Symbol | PAX7 |
Synonyms | PAX7; paired box 7; paired box gene 7; paired box protein Pax-7; Hup1; |
Gene ID | 5081 |
mRNA Refseq | NM_001135254 |
Protein Refseq | NP_001128726 |
MIM | 167410 |
Uniprot ID | P23759 |
Chromosome Location | 1p36.13 |
Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
PAX7-6622C | Recombinant Chicken PAX7 | +Inquiry |
PAX7-2924H | Recombinant Human PAX7 protein, His-tagged | +Inquiry |
PAX7-29057TH | Recombinant Human PAX7 | +Inquiry |
PAX7-132H | Recombinant Human PAX7 protein, T7/His-tagged | +Inquiry |
PAX7-6754H | Recombinant Human PAX7 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX7-3414HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
PAX7-3413HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAX7 Products
Required fields are marked with *
My Review for All PAX7 Products
Required fields are marked with *
0
Inquiry Basket