Recombinant Human PAX7 protein, His-tagged
Cat.No. : | PAX7-2924H |
Product Overview : | Recombinant Human PAX7 protein(330-378 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 330-378 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | STMHQGGLAAAAAAADTSSAYGARHSFSSYSDSFMNPAAPSNHMNPVSN |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PAX7 paired box 7 [ Homo sapiens ] |
Official Symbol | PAX7 |
Synonyms | PAX7; paired box 7; paired box gene 7; paired box protein Pax-7; Hup1; paired domain gene 7; paired box homeotic gene 7; PAX7 transcriptional factor; HUP1; RMS2; PAX7B; FLJ37460; |
mRNA Refseq | NM_001135254 |
Protein Refseq | NP_001128726 |
MIM | 167410 |
UniProt ID | P23759 |
Gene ID | 5081 |
◆ Recombinant Proteins | ||
PAX7-4801H | Recombinant Human PAX7 Protein (Arg355-Gln467), N-His tagged | +Inquiry |
PAX7-2924H | Recombinant Human PAX7 protein, His-tagged | +Inquiry |
PAX7-6622C | Recombinant Chicken PAX7 | +Inquiry |
PAX7-29057TH | Recombinant Human PAX7 | +Inquiry |
PAX7-132H | Recombinant Human PAX7 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX7-3413HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
PAX7-3414HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAX7 Products
Required fields are marked with *
My Review for All PAX7 Products
Required fields are marked with *