Recombinant Human PAX7 protein, GST-tagged
| Cat.No. : | PAX7-6754H |
| Product Overview : | Recombinant Human PAX7 protein(330-378 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 330-378 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | STMHQGGLAAAAAAADTSSAYGARHSFSSYSDSFMNPAAPSNHMNPVSN |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | PAX7 paired box 7 [ Homo sapiens ] |
| Official Symbol | PAX7 |
| Synonyms | PAX7; paired box 7; paired box gene 7; paired box protein Pax-7; Hup1; paired domain gene 7; paired box homeotic gene 7; PAX7 transcriptional factor; HUP1; RMS2; PAX7B; FLJ37460; |
| mRNA Refseq | NM_001135254 |
| Protein Refseq | NP_001128726 |
| MIM | 167410 |
| UniProt ID | P23759 |
| Gene ID | 5081 |
| ◆ Recombinant Proteins | ||
| PAX7-29057TH | Recombinant Human PAX7 | +Inquiry |
| PAX7-4801H | Recombinant Human PAX7 Protein (Arg355-Gln467), N-His tagged | +Inquiry |
| PAX7-6754H | Recombinant Human PAX7 protein, GST-tagged | +Inquiry |
| PAX7-132H | Recombinant Human PAX7 protein, T7/His-tagged | +Inquiry |
| PAX7-6622C | Recombinant Chicken PAX7 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PAX7-3413HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
| PAX7-3414HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAX7 Products
Required fields are marked with *
My Review for All PAX7 Products
Required fields are marked with *



