Recombinant Human PDGFA protein

Cat.No. : PDGFA-57H
Product Overview : Recombinant Human PDGFA(Ser87-Thr211) was expressed in E. coli.
Availability July 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : Ser87-Thr211
Form : Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
AA Sequence : SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVK VAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name PDGFA platelet-derived growth factor alpha polypeptide [ Homo sapiens ]
Official Symbol PDGFA
Synonyms PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A;
Gene ID 5154
mRNA Refseq NM_002607
Protein Refseq NP_002598
MIM 173430
UniProt ID P04085
Chromosome Location 7p22
Pathway Ceramide signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function cell surface binding; collagen binding; eukaryotic cell surface binding; growth factor activity; platelet-derived growth factor binding; platelet-derived growth factor receptor binding; contributes_to platelet-derived growth factor receptor binding; platelet-derived growth factor receptor binding; protein heterodimerization activity; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDGFA Products

Required fields are marked with *

My Review for All PDGFA Products

Required fields are marked with *

0
cart-icon