Recombinant Human PDGFA protein
Cat.No. : | PDGFA-57H |
Product Overview : | Recombinant Human PDGFA(Ser87-Thr211) was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | Ser87-Thr211 |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4 |
AA Sequence : | SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVK VAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | PDGFA platelet-derived growth factor alpha polypeptide [ Homo sapiens ] |
Official Symbol | PDGFA |
Synonyms | PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A; |
Gene ID | 5154 |
mRNA Refseq | NM_002607 |
Protein Refseq | NP_002598 |
MIM | 173430 |
UniProt ID | P04085 |
Chromosome Location | 7p22 |
Pathway | Ceramide signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; |
Function | cell surface binding; collagen binding; eukaryotic cell surface binding; growth factor activity; platelet-derived growth factor binding; platelet-derived growth factor receptor binding; contributes_to platelet-derived growth factor receptor binding; platelet-derived growth factor receptor binding; protein heterodimerization activity; protein homodimerization activity; |
◆ Recombinant Proteins | ||
PDGFA-2569H | Recombinant Human PDGFA Protein, His-tagged | +Inquiry |
Pdgfa-048M | Recombinant Mouse Pdgfa Protein | +Inquiry |
PDGFA-1392H | Recombinant Human PDGFA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDGFA-514M | Recombinant Mouse PDGFA protein(Ser87-Arg196), His-tagged | +Inquiry |
Pdgfa-215R | Active Recombinant Rat Pdgfa | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFA-3337HCL | Recombinant Human PDGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFA Products
Required fields are marked with *
My Review for All PDGFA Products
Required fields are marked with *
0
Inquiry Basket