"IL1RL1" Related Products

Expand
Expand

Recombinant Human ST2 Protein

Cat.No.: IL1RL1-1009H
Product Overview: Recombinant Human ST2 also known as interleukin-1receptor-like 1 antigen is produced by mammalian expression system and the target gene encoding Lys19- Phe328 is expressed with a 6His tag at the C-terminus. Predicted molecular weight: 60 kDa.
Description: ST2 is an interleukin-1 family receptor expressed in the heart. ST2 protein has two isoforms: a soluble (sST2) and membrane- bound form. Patients with heart failure and elevated ST2 protein levels in the blood are at risk for heart failure progression.
Source: Human cells
Species: Human
Tag : His
Form: Lyophilized
Bio-activity: Anti-h ST2 10201: + Anti-h ST2 10202: + Anti-h ST2 10203: + Anti-h ST2 10204: + Anti-h ST2 10205: + Anti-h ST2 10206: + Anti-h ST2 10207: +
Molecular Mass: 60kDa
AA Sequence: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSG IYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWF KNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPV IGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSN GLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECFVDHHHHHH
Purity: >90% by SDS-PAGE
Storage: -20centigrade
Concentration: 0.5 mg/ml when reconstituted with 100 µl of deionized wate
Storage Buffer: 20 mM Na-phosphate, pH 7.4, 150 mM NaCl
Reconstitution: Reconstitute lyophilized protein with 100 µl of deionized water
Gene Name: IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ]
Official Symbol: IL1RL1
Synonyms: IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623;
Gene ID: 9173
mRNA Refseq: NM_003856
Protein Refseq: NP_003847
MIM: 601203
UniProt ID: Q01638

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.