| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
Non |
| Description : |
Teratocarcinoma-derived growth factor 1 is the founding member of the EGF-CFC gene family, which is conserved among vertebrates. Proteins within this family contain a signal sequence, a characteristic EGF-like domain, a cysteine-rich region termed the cryptic (CFC) motif, and a hydrophobic C? terminus. It has been reported that Cripto-1 is O-fucosylated on Thr-88 and that this modification is required for the physical interaction with Nodal as well as for signalling activity. We have confirmed that teratocarcinoma-derived growth factor 1 is O-fucosylated at this site. |
| Amino Acid Sequence : |
LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTC MLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFL PGCDGLVMDEHLVASRTPELPPS. |
| Molecular Mass : |
Under reducing conditions teratocarcinoma-derived growth factor 1 migrates as a broad band between 20 and 30 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Cripto-1 polypeptide that has a predicted monomeric molecular mass of 15.6 kDa. |
| pI : |
Teratocarcinoma-derived growth factor 1 has a predicted pI of 8.04. |
| % Carbohydrate : |
Purified teratocarcinoma-derived growth factor 1 consists of 20-50% carbohydrate by weight. |
| Glycosylation : |
Teratocarcinoma-derived growth factor 1 contains N- and O-linked oligosaccharides with confirmed O-fucosylation at Thr-88. |
| Purity : |
>95%, as determined by SDS-PAGE, visualised by Coomassie Brilliant Blue. |
| Formulation : |
When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
| Reconstitution : |
It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
| Storage : |
Lyophilised products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
| Activity : |
Teratocarcinoma-derived growth factor 1 has been shown to stimulate MAPK phosphorylation in HUVEC cells. 200ng/ml is sufficient to stimulate phosphorylation. |