Recombinant Human Teratocarcinoma-Derived Growth Factor 1
Cat.No. : | TDGF1-495H |
Product Overview : | Recombinant Human teratocarcinoma-derived growth factor 1 encoding the human teratocarcinoma-derived growth factor 1 protein (comprising the signal peptide sequence and the first 139 amino acids of the mature protein, encompassing the EGF-like domain) was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Description : | Teratocarcinoma-derived growth factor 1 is the founding member of the EGF-CFC gene family, which is conserved among vertebrates. Proteins within this family contain a signal sequence, a characteristic EGF-like domain, a cysteine-rich region termed the cryptic (CFC) motif, and a hydrophobic C? terminus. It has been reported that Cripto-1 is O-fucosylated on Thr-88 and that this modification is required for the physical interaction with Nodal as well as for signalling activity. We have confirmed that teratocarcinoma-derived growth factor 1 is O-fucosylated at this site. |
Amino Acid Sequence : | LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTC MLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFL PGCDGLVMDEHLVASRTPELPPS. |
Molecular Mass : | Under reducing conditions teratocarcinoma-derived growth factor 1 migrates as a broad band between 20 and 30 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Cripto-1 polypeptide that has a predicted monomeric molecular mass of 15.6 kDa. |
pI : | Teratocarcinoma-derived growth factor 1 has a predicted pI of 8.04. |
% Carbohydrate : | Purified teratocarcinoma-derived growth factor 1 consists of 20-50% carbohydrate by weight. |
Glycosylation : | Teratocarcinoma-derived growth factor 1 contains N- and O-linked oligosaccharides with confirmed O-fucosylation at Thr-88. |
Purity : | >95%, as determined by SDS-PAGE, visualised by Coomassie Brilliant Blue. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilised products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : | Teratocarcinoma-derived growth factor 1 has been shown to stimulate MAPK phosphorylation in HUVEC cells. 200ng/ml is sufficient to stimulate phosphorylation. |
Gene Name | TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ] |
Synonyms | TDGF1; teratocarcinoma-derived growth factor 1; CR; CRGF; CRIPTO; Cripto-1; Epidermal growth factor-like cripto protein CR1; Cripto-1 growth factor |
Gene ID | 6997 |
mRNA Refseq | NM_003212 |
Protein Refseq | NP_003203 |
UniProt ID | P13385 |
Chromosome Location | 3p21.31 |
MIM | 187395 |
Function | growth factor activity |
◆ Recombinant Proteins | ||
TDGF1-6407H | Recombinant Human TDGF1 Protein (Leu31-Ser169), C-Fc tagged | +Inquiry |
TDGF1-496H | Active Recombinant Human TDGF1, Fc Chimera | +Inquiry |
TDGF1-526H | Active Recombinant Human TDGF1 | +Inquiry |
TDGF1-572H | Active Recombinant Human TDGF1 protein, His-tagged | +Inquiry |
TDGF1-295H | Recombinant Human TDGF1 Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDGF1-832RCL | Recombinant Rat TDGF1 cell lysate | +Inquiry |
TDGF1-2432HCL | Recombinant Human TDGF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDGF1 Products
Required fields are marked with *
My Review for All TDGF1 Products
Required fields are marked with *
0
Inquiry Basket