Recombinant Human Teratocarcinoma-Derived Growth Factor 1

Cat.No. : TDGF1-495H
Product Overview : Recombinant Human teratocarcinoma-derived growth factor 1 encoding the human teratocarcinoma-derived growth factor 1 protein (comprising the signal peptide sequence and the first 139 amino acids of the mature protein, encompassing the EGF-like domain) was expressed in modifiedhuman 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Non
Description : Teratocarcinoma-derived growth factor 1 is the founding member of the EGF-CFC gene family, which is conserved among vertebrates. Proteins within this family contain a signal sequence, a characteristic EGF-like domain, a cysteine-rich region termed the cryptic (CFC) motif, and a hydrophobic C? terminus. It has been reported that Cripto-1 is O-fucosylated on Thr-88 and that this modification is required for the physical interaction with Nodal as well as for signalling activity. We have confirmed that teratocarcinoma-derived growth factor 1 is O-fucosylated at this site.
Amino Acid Sequence : LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTC MLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFL PGCDGLVMDEHLVASRTPELPPS.
Molecular Mass : Under reducing conditions teratocarcinoma-derived growth factor 1 migrates as a broad band between 20 and 30 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Cripto-1 polypeptide that has a predicted monomeric molecular mass of 15.6 kDa.
pI : Teratocarcinoma-derived growth factor 1 has a predicted pI of 8.04.
% Carbohydrate : Purified teratocarcinoma-derived growth factor 1 consists of 20-50% carbohydrate by weight.
Glycosylation : Teratocarcinoma-derived growth factor 1 contains N- and O-linked oligosaccharides with confirmed O-fucosylation at Thr-88.
Purity : >95%, as determined by SDS-PAGE, visualised by Coomassie Brilliant Blue.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilised products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity : Teratocarcinoma-derived growth factor 1 has been shown to stimulate MAPK phosphorylation in HUVEC cells. 200ng/ml is sufficient to stimulate phosphorylation.
Gene Name TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ]
Synonyms TDGF1; teratocarcinoma-derived growth factor 1; CR; CRGF; CRIPTO; Cripto-1; Epidermal growth factor-like cripto protein CR1; Cripto-1 growth factor
Gene ID 6997
mRNA Refseq NM_003212
Protein Refseq NP_003203
UniProt ID P13385
Chromosome Location 3p21.31
MIM 187395
Function growth factor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TDGF1 Products

Required fields are marked with *

My Review for All TDGF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon