Recombinant Human TNFSF4 Protein, His-tagged

• Cat.No.: TNFSF4-142H
• Product Overview: Recombinant Human TNFSF4 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: OX40 (TNFRSF4, CD134) is a member of the tumor necrosis factor (TNF) receptor superfamily that regulates T cell activity and immune responses. The OX40 protein contains four cysteine rich domains, a transmembrane domain, and a cytoplasmic tail containing a QEE motif. OX40 is primarily expressed on activated CD4+ and CD8+ T-cells, while the OX40 ligand (OX40L, TNFSF4, CD252) is predominantly expressed on activated antigen presenting cells. The engagement of OX40 with OX40L leads to the recruitment of TNF receptor-associated factors (TRAFs) and results in the formation of a TCR-independent signaling complex. One component of this complex, PKCθ, activates the NF-κB pathway. OX40 signaling through Akt can also enhance TCR signaling directly. Research studies indicate that the OX40L-OX40 pathway is associated with inflammation and autoimmune diseases. Additional research studies show that OX40 agonists augment anti-tumor immunity in several cancer types.
• Molecular Mass: ~15 kDa
• AA Sequence: MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: TNFSF4 tumor necrosis factor (ligand) superfamily, member 4 [ Homo sapiens (human) ]
• Official Symbol: TNFSF4
• Synonyms: TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tax transcriptionally activated glycoprotein 1, 34kD , TXGP1; tumor necrosis factor ligand superfamily member 4; CD252; gp34; OX 40L; OX40L; CD134 ligand; glycoprotein Gp34; OX40 antigen ligand; TAX transcriptionally-activated glycoprotein 1; tax-transcriptionally activated glycoprotein 1 (34kD); GP34; OX4OL; TXGP1; CD134L; OX-40L
• Gene ID: 7292
• mRNA Refseq: NM_003326
• Protein Refseq: NP_003317
• MIM: 603594
• UniProt ID: P23510