Recombinant Human TNFSF4 Protein, His-tagged
Cat.No. : | TNFSF4-142H |
Product Overview : | Recombinant Human TNFSF4 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | OX40 (TNFRSF4, CD134) is a member of the tumor necrosis factor (TNF) receptor superfamily that regulates T cell activity and immune responses. The OX40 protein contains four cysteine rich domains, a transmembrane domain, and a cytoplasmic tail containing a QEE motif. OX40 is primarily expressed on activated CD4+ and CD8+ T-cells, while the OX40 ligand (OX40L, TNFSF4, CD252) is predominantly expressed on activated antigen presenting cells. The engagement of OX40 with OX40L leads to the recruitment of TNF receptor-associated factors (TRAFs) and results in the formation of a TCR-independent signaling complex. One component of this complex, PKCθ, activates the NF-κB pathway. OX40 signaling through Akt can also enhance TCR signaling directly. Research studies indicate that the OX40L-OX40 pathway is associated with inflammation and autoimmune diseases. Additional research studies show that OX40 agonists augment anti-tumor immunity in several cancer types. |
Molecular Mass : | ~15 kDa |
AA Sequence : | MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | TNFSF4 tumor necrosis factor (ligand) superfamily, member 4 [ Homo sapiens (human) ] |
Official Symbol | TNFSF4 |
Synonyms | TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tax transcriptionally activated glycoprotein 1, 34kD , TXGP1; tumor necrosis factor ligand superfamily member 4; CD252; gp34; OX 40L; OX40L; CD134 ligand; glycoprotein Gp34; OX40 antigen ligand; TAX transcriptionally-activated glycoprotein 1; tax-transcriptionally activated glycoprotein 1 (34kD); GP34; OX4OL; TXGP1; CD134L; OX-40L; |
Gene ID | 7292 |
mRNA Refseq | NM_003326 |
Protein Refseq | NP_003317 |
MIM | 603594 |
UniProt ID | P23510 |
◆ Recombinant Proteins | ||
TNFSF4-490HAF488 | Recombinant Human TNFSF4 Protein, hFc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TNFSF4-0924H | Recombinant Human TNFSF4 Protein (Gln51-Leu183), N-His tagged | +Inquiry |
TNFSF4-0588H | Active Recombinant Human TNFSF4 protein, His-Avi-tagged, Biotinylated | +Inquiry |
Tnfsf4-407M | Active Recombinant Mouse Tnfsf4, FLAG-tagged | +Inquiry |
TNFSF4-1935HFL | Recombinant Full Length Human TNFSF4 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF4-857CCL | Recombinant Cynomolgus TNFSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF4 Products
Required fields are marked with *
My Review for All TNFSF4 Products
Required fields are marked with *