Recombinant Monkey MAP4K1 Protein, C-His tagged

Cat.No. : MAP4K1-03M
Product Overview : Recombinant Monkey MAP4K1 Protein with C-His tag was expressed in Insect cells.
Availability May 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Monkey
Source : Insect Cells
Tag : His
Description : Enables ATP binding activity and MAP kinase kinase kinase kinase activity. Involved in several processes, including JNK cascade; cellular response to phorbol 13-acetate 12-myristate; and protein phosphorylation. Located in membrane.
Molecular Mass : The protein has a calculated MW of 34.49 kDa.
AA Sequence : GSATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAPRDHYDLLQRLGGGTYGEVFKARDKASGDLVALKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILVNDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVHHHHHH
Purity : > 60% by SDS-PAGE
Storage : Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.2 mg/mL
Storage Buffer : PBS, pH 7.4
Gene Name MAP4K1 mitogen-activated protein kinase kinase kinase kinase 1 [ Macaca mulatta ]
Official Symbol MAP4K1
Synonyms MAP4K1; mitogen-activated protein kinase kinase kinase kinase 1;
Gene ID 694259
mRNA Refseq XM_028840014
Protein Refseq XP_028695847
UniProt ID A0A1D5R952

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MAP4K1 Products

Required fields are marked with *

My Review for All MAP4K1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon