Recombinant Monkey MAP4K1 Protein, C-His tagged
Cat.No. : | MAP4K1-03M |
Product Overview : | Recombinant Monkey MAP4K1 Protein with C-His tag was expressed in Insect cells. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Monkey |
Source : | Insect Cells |
Tag : | His |
Description : | Enables ATP binding activity and MAP kinase kinase kinase kinase activity. Involved in several processes, including JNK cascade; cellular response to phorbol 13-acetate 12-myristate; and protein phosphorylation. Located in membrane. |
Molecular Mass : | The protein has a calculated MW of 34.49 kDa. |
AA Sequence : | GSATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAPRDHYDLLQRLGGGTYGEVFKARDKASGDLVALKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILVNDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVHHHHHH |
Purity : | > 60% by SDS-PAGE |
Storage : | Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.2 mg/mL |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | MAP4K1 mitogen-activated protein kinase kinase kinase kinase 1 [ Macaca mulatta ] |
Official Symbol | MAP4K1 |
Synonyms | MAP4K1; mitogen-activated protein kinase kinase kinase kinase 1; |
Gene ID | 694259 |
mRNA Refseq | XM_028840014 |
Protein Refseq | XP_028695847 |
UniProt ID | A0A1D5R952 |
◆ Recombinant Proteins | ||
MAP4K1-20399H | Recombinant Human MAP4K1 Protein, His tagged | +Inquiry |
MAP4K1-27602TH | Active Recombinant Full Length Human MAP4K1 Protein, GST tagged | +Inquiry |
MAP4K1-1041H | Recombinant Human Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1, GST-tagged | +Inquiry |
MAP4K1-79H | Recombinant Human MAP4K1 Protein, GST-tagged | +Inquiry |
MAP4K1-135H | Recombinant Human mitogen-activated protein kinase kinase kinase kinase 1 Protein, His&Flag&StrepII tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP4K1 Products
Required fields are marked with *
My Review for All MAP4K1 Products
Required fields are marked with *