Recombinant Mouse CCL20 Protein
Cat.No. : | CCL20-18M |
Product Overview : | Recombinant Mouse CCL20 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Macrophage inflammatory protein-3 alpha (MIP-3 α), also called CCL20, is expressed in the liver, lungs, lymph nodes, and peripheral blood lymphocytes. MIP-3 α expression is strongly induced by inflammatory signals, and downregulated by the anti-inflammatory cytokine interleukin 10 (IL-10). MIP-3 α signals through the G protein-coupled receptor CCR6 to function as a chemoattractant to lymphocytes and dendritic cells. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 8 kDa (70 aa) |
AA Sequence : | ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Ccl20 chemokine (C-C motif) ligand 20 [ Mus musculus (house mouse) ] |
Official Symbol | CCL20 |
Synonyms | CCL20; chemokine (C-C motif) ligand 20; C-C motif chemokine 20; MIP-3-alpha; CC chemokine LARC; CC chemokine ST38; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; small inducible cytokine subfamily A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; CKb4; LARC; ST38; MIP3A; MIP-3A; Scya20; MIP-3[a]; exodus-1; |
Gene ID | 20297 |
mRNA Refseq | NM_001159738 |
Protein Refseq | NP_001153210 |
UniProt ID | O89093 |
◆ Recombinant Proteins | ||
Ccl20-719R | Recombinant Rat Ccl20 protein, His & GST-tagged | +Inquiry |
Ccl20-2888R | Recombinant Rat Ccl20 Protein | +Inquiry |
CCL20-0752H | Recombinant Human CCL20 Protein (Ser28-Met96), N-His tagged | +Inquiry |
CCL20-717H | Recombinant Human CCL20 protein, His & GST-tagged | +Inquiry |
CCL20-641H | Recombinant Human CCL20 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL20-447MCL | Recombinant Mouse CCL20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL20 Products
Required fields are marked with *
My Review for All CCL20 Products
Required fields are marked with *
0
Inquiry Basket