Recombinant Mouse Egf Protein, His-tagged

Cat.No. : Egf-054M
Product Overview : Purified recombinant protein of Mouse epidermal growth factor with C-terminal His tag, expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis.
Molecular Mass : 7.1 kDa
AA Sequence : NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELRLEHHHHHH
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.2
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name Egf epidermal growth factor [ Mus musculus (house mouse) ]
Official Symbol Egf
Synonyms Egf; epidermal growth factor; AI790464; pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF)
Gene ID 13645
mRNA Refseq NM_010113
Protein Refseq NP_034243
UniProt ID P01132

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Egf Products

Required fields are marked with *

My Review for All Egf Products

Required fields are marked with *

0

Inquiry Basket

cartIcon