Recombinant Human FCER1A Protein, His-SUMO-tagged
Cat.No. : | FCER1A-1209H |
Product Overview : | Recombinant Human FCER1A Protein (26-205aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 26-205 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 37.0 kDa |
AA Sequence : | VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQH QQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITN ATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens ] |
Official Symbol | FCER1A |
Synonyms | FCER1A; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; FCE1A; high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide; FcERI |
Gene ID | 2205 |
mRNA Refseq | NM_002001 |
Protein Refseq | NP_001992 |
MIM | 147140 |
UniProt ID | P12319 |
◆ Recombinant Proteins | ||
FCER1A-25H | Active Recombinant Human FCER1A Protein (26-205aa), C-His tagged | +Inquiry |
FCER1A-1459C | Active Recombinant Cynomolgus FCER1A protein, Fc-tagged | +Inquiry |
FCER1A-2304R | Recombinant Rat Fc epsilon receptor Ia Protein, His tagged | +Inquiry |
FCER1A-2099H | Recombinant Human FCER1A Protein (26-205 aa), His-tagged | +Inquiry |
FCER1A-245H | Recombinant Human FCER1A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCER1A Products
Required fields are marked with *
My Review for All FCER1A Products
Required fields are marked with *
0
Inquiry Basket