Recombinant Human FCER1A Protein, His-SUMO-tagged
| Cat.No. : | FCER1A-1209H |
| Product Overview : | Recombinant Human FCER1A Protein (26-205aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 26-205 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 37.0 kDa |
| AA Sequence : | VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQH QQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITN ATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens ] |
| Official Symbol | FCER1A |
| Synonyms | FCER1A; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; FCE1A; high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide; FcERI |
| Gene ID | 2205 |
| mRNA Refseq | NM_002001 |
| Protein Refseq | NP_001992 |
| MIM | 147140 |
| UniProt ID | P12319 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER1A Products
Required fields are marked with *
My Review for All FCER1A Products
Required fields are marked with *
