Active Recombinant Mouse Ifng Protein

Cat.No. : Ifng-078M
Product Overview : Purified recombinant protein of Mouse interferon gamma (Ifng) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mice deficient in this gene have increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.
Bio-activity : Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED50 is less than or equal to 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg.
Molecular Mass : 15.6 kDa
AA Sequence : MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Ifng interferon gamma [ Mus musculus (house mouse) ]
Official Symbol Ifng
Synonyms Ifng; interferon gamma; Ifg; IFN-g; interferon gamma; IFN-gamma; gamma interferon
Gene ID 15978
mRNA Refseq NM_008337
Protein Refseq NP_032363
UniProt ID P01580

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ifng Products

Required fields are marked with *

My Review for All Ifng Products

Required fields are marked with *

0
cart-icon