"Il33" Related Products

Expand
Expand
Expand

Recombinant Mouse Il33 Protein

Cat.No. : Il33-5186M
Product Overview : Mouse Il33 (Q8BVZ5, 109 a.a. - 266 a.a.) partial recombinant protein expressed in Escherichia coli.
Description : Interleukin 33 (IL-33) is a protein that in humans is encoded by the IL33 gene. Interleukin 33 is a member of the IL-1 family that potently drives production of T helper-2 (Th2)-associated cytokines (e.g., IL-4). IL33 is a ligand for ST2 (IL1RL1), an IL-1 family receptor that is highly expressed on Th2 cells, mast cells and group 2 innate lymphocytes. IL-33 is expressed by a wide variety of cell types, including fibroblasts, mast cells, dendritic cells, macrophages, osteoblasts, endothelial cells, and epithelial cells.
Source : E. coli
Species : Mouse
Form : Lyophilized
Bio-activity : The ED50 was determined by the dose-dependent proliferation of murine D10S cells is ≤ 0.3 ng/mL.
Molecular Mass : 18 kDa
AA Sequence : SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Endotoxin : Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/μg (1EU/μg).
Purity : > 90% by SDS-PAGE and HPLC
Applications : Functional Study
SDS-PAGE
Storage : Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from PBS, pH 7.5
Gene Name : Il33 interleukin 33 [ Mus musculus ]
Official Symbol : Il33
Synonyms : IL33; interleukin 33; interleukin-33; nuclear factor from high endothelial venules; Il-33; Il1f11; NF-HEV; 9230117N10Rik;
Gene ID : 77125
mRNA Refseq : NM_001164724
Protein Refseq : NP_001158196

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.