Recombinant Mouse Il33 Protein, His-tagged

Cat.No. : Il33-7419M
Product Overview : Recombinant mouse IL33 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 109-266
Description : In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.
Form : Liquid
Molecular Mass : 18.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate buffered saline, 10 % glycerol, 1 mM DTT.
Gene Name Il33 interleukin 33 [ Mus musculus (house mouse) ]
Official Symbol Il33
Synonyms Il33; interleukin 33; Il-; Il1f; NF-H; Il-33; Il1f11; NF-HEV; 9230117N10Rik; interleukin-33; nuclear factor from high endothelial venules
Gene ID 77125
mRNA Refseq NM_001164724
Protein Refseq NP_001158196
UniProt ID Q8BVZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il33 Products

Required fields are marked with *

My Review for All Il33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon