| Species : |
Mouse |
| Source : |
E.coli |
| Description : |
In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation. |
| Bio-activity : |
ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is less than or equal to 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6units/mg. |
| Molecular Mass : |
17.5 kDa |
| AA Sequence : |
SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
| Endotoxin : |
Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : |
>95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : |
Store at -80 centigrade. |
| Storage Buffer : |
Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Reconstitution : |
Resuspend the protein in the desired concentration in proper buffer. |
