Active Recombinant Mouse Il33 Protein

Cat.No. : Il33-158M
Product Overview : Purified recombinant protein of Mouse interleukin 33 (Il33), transcript variant 2 without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.
Bio-activity : ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is less than or equal to 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6units/mg.
Molecular Mass : 17.5 kDa
AA Sequence : SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Il33 interleukin 33 [ Mus musculus (house mouse) ]
Official Symbol Il33
Synonyms Il33; interleukin 33; Il-33; Il1f11; NF-HEV; 9230117N10Rik; interleukin-33; nuclear factor from high endothelial venules
Gene ID 77125
mRNA Refseq NM_133775
Protein Refseq NP_598536
UniProt ID Q8BVZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il33 Products

Required fields are marked with *

My Review for All Il33 Products

Required fields are marked with *

0
cart-icon