Active Recombinant Mouse Il33 Protein
Cat.No. : | Il33-158M |
Product Overview : | Purified recombinant protein of Mouse interleukin 33 (Il33), transcript variant 2 without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation. |
Bio-activity : | ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is less than or equal to 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6units/mg. |
Molecular Mass : | 17.5 kDa |
AA Sequence : | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il33 interleukin 33 [ Mus musculus (house mouse) ] |
Official Symbol | Il33 |
Synonyms | Il33; interleukin 33; Il-33; Il1f11; NF-HEV; 9230117N10Rik; interleukin-33; nuclear factor from high endothelial venules |
Gene ID | 77125 |
mRNA Refseq | NM_133775 |
Protein Refseq | NP_598536 |
UniProt ID | Q8BVZ5 |
◆ Recombinant Proteins | ||
IL33-110H | Recombinant Human IL33 Protein | +Inquiry |
IL33-165H | Recombinant Human IL33 Protein, Avi-tagged | +Inquiry |
IL33-1034C | Active Recombinant Canine IL33 protein | +Inquiry |
Il33-2061M | Recombinant Mouse Il33 protein, GST-tagged | +Inquiry |
IL33-123H | Recombinant Human Interleukin 33, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il33 Products
Required fields are marked with *
My Review for All Il33 Products
Required fields are marked with *
0
Inquiry Basket