Recombinant Dog IL33 protein(102-263aa), His-tagged
| Cat.No. : | IL33-4211D |
| Product Overview : | Recombinant Dog IL33 protein(O97863)(102-263aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 102-263aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 22.5 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS |
| Gene Name | IL33 interleukin 33 [ Canis lupus familiaris ] |
| Official Symbol | IL33 |
| Synonyms | IL33; interleukin 33; interleukin-33; IL-33; DVS27; |
| Gene ID | 403810 |
| mRNA Refseq | NM_001003180 |
| Protein Refseq | NP_001003180 |
| ◆ Recombinant Proteins | ||
| IL33-2218H | Active Recombinant Human IL33 protein, His-tagged | +Inquiry |
| IL33-3103P | Recombinant Pig IL33 protein, GST-tagged | +Inquiry |
| IL33-486H | Active Recombinant Human IL33 Protein | +Inquiry |
| IL33-5783HF | Recombinant Full Length Human IL33 Protein, GST-tagged | +Inquiry |
| IL33-312H | Active Recombinant Human IL33 Protein (Ser112-Thr270), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL33 Products
Required fields are marked with *
My Review for All IL33 Products
Required fields are marked with *
