Recombinant Mouse Osm protein

Cat.No. : Osm-524M
Product Overview : Recombinant Mouse Osm protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 181
Description : Oncostatin M (OSM) is a multifunctional cytokine that belongs to the Interleukin-6 subfamily. Among the family members, OSM is most closely related to leukemia inhibitory factor (LIF) and it in fact utilizes the LIF receptor in addition to its specific receptor in the human. A biologically active OSM receptor has been previously described that consists of a heterodimer of leukemia inhibitory factor receptor (LIFR) and gp130. OSM is synthesized by stimulated T-cells and monocytes. Furthermore, the effects of OSM on endothelial cells suggest a pro-inflammatory role for OSM and endothelial cells possess a large number of OSM receptors. Recombinant murine OSM contains 181 amino acids and has a molecular mass of 20.4 kDa. It has approximately 48 % and 72 % amino acid sequence identity with human and rat OSM.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, 5 % trehalose.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NIH-3T3 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 20.4 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids.
AA Sequence : NRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSR
Endotoxin : Less than 1 EU/μg of rMuOSM as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Osm
Official Symbol Osm
Synonyms OSM; oncostatin M; oncostatin-M; OncoM;
Gene ID 18413
mRNA Refseq NM_001013365
Protein Refseq NP_001013383
UniProt ID P53347

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Osm Products

Required fields are marked with *

My Review for All Osm Products

Required fields are marked with *

0

Inquiry Basket

cartIcon