Active Recombinant Human OSM Protein

Cat.No. : OSM-220H
Product Overview : Recombinant Human OSM Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Oncostatin M is a cytokine that is produced by macrophages, dendritic cells, and T lymphocytes during inflammatory events. The Type-I and Type-II Oncostatin M receptors are located on the cell surface of endothelial and tumor cells, contain the glycoprotein 130 (gp130) subunit, and activate the JAK/STAT signaling pathway. Oncostatin M functions to inhibit tumor cell proliferation, induce liver stem cell maturation, regulate cytokine production during hematopoiesis and inflammation, stimulate bone formation, and promote nervous system development.
Bio-activity : TF-1 cell proliferation, ≤4 ng/mL
Molecular Mass : Monomer, 23.8 kDa (210 aa)
AA Sequence : MAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name OSM oncostatin M [ Homo sapiens (human) ]
Official Symbol OSM
Synonyms OSM; oncostatin M; oncostatin-M; MGC20461;
Gene ID 5008
mRNA Refseq NM_020530
Protein Refseq NP_065391
MIM 165095
UniProt ID P13725

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OSM Products

Required fields are marked with *

My Review for All OSM Products

Required fields are marked with *

0
cart-icon
0
compare icon