Recombinant Mouse S100a5 Protein, His-tagged

Cat.No. : S100a5-7325M
Product Overview : Recombinant mouse S100A5 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-93
Description : Binds calcium, zinc and copper. One subunit can simultaneously bind 2 calcium ions or 2 copper ions plus 1 zinc ion. Calcium and copper ions compete for the same binding sites.
Form : Liquid
Molecular Mass : 13.4 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSHMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKTELSLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer, pH 8.0, 40 % glycerol, 3 mM DTT, 200 mM NaCl
Gene Name S100a5 S100 calcium binding protein A5 [ Mus musculus (house mouse) ]
Official Symbol S100a5
Synonyms S100a5; S100 calcium binding protein A5; S100D; S100D9; protein S100-A5
Gene ID 20199
mRNA Refseq NM_011312
Protein Refseq NP_035442
UniProt ID P63084

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100a5 Products

Required fields are marked with *

My Review for All S100a5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon