Recombinant Human S100A5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100A5-5408H |
Product Overview : | S100A5 MS Standard C13 and N15-labeled recombinant protein (NP_002953) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain. |
Molecular Mass : | 12.8 kDa |
AA Sequence : | MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100A5 S100 calcium binding protein A5 [ Homo sapiens (human) ] |
Official Symbol | S100A5 |
Synonyms | S100A5; S100 calcium binding protein A5; S100 calcium binding protein A5, S100D; protein S100-A5; S100 calcium-binding protein A5; S100D; |
Gene ID | 6276 |
mRNA Refseq | NM_002962 |
Protein Refseq | NP_002953 |
MIM | 176991 |
UniProt ID | P33763 |
◆ Recombinant Proteins | ||
S100A5-430H | Recombinant Human S100 Calcium Binding Protein A5 | +Inquiry |
S100A5-3877H | Recombinant Human S100A5 protein, His-tagged | +Inquiry |
S100A5-5214R | Recombinant Rat S100A5 Protein | +Inquiry |
S100A5-5408H | Recombinant Human S100A5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100a5-5588M | Recombinant Mouse S100 Calcium Binding Protein A5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A5-2089HCL | Recombinant Human S100A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A5 Products
Required fields are marked with *
My Review for All S100A5 Products
Required fields are marked with *
0
Inquiry Basket